Streptomyces formicae: KY5_3424 Help Entry KY5_3424          CDS       T05416                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism sfk  Streptomyces formicae Pathway sfk00261   Monobactam biosynthesis sfk01100   Metabolic pathways sfk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KY5_3424  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sfk01008]     KY5_3424 Polyketide biosynthesis proteins [BR:sfk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KY5_3424 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ATL28442 UniProt:  A0A291Q9Z0 LinkDB All DBs Position 4047294..4047473 Genome browser AA seq 59 aa AA seqDB search MTTSEAPANPFDADGEFLVLANERGELSLWPLFAAVPEGWSAQHGPGPRQDALDRIASR NT seq 180 nt NT seq  +upstreamnt  +downstreamnt gtgacgacgagcgaagcccccgccaaccccttcgacgcggacggcgagttcctggtcctc gccaacgaacgcggcgaactctcgctctggccgctcttcgccgccgtgcccgagggttgg tcggcgcagcacggcccgggcccgcgtcaggacgctctggatcggatcgcgtcccggtga

DBGET integrated database retrieval system