Streptomyces formicae: KY5_6269 Help Entry KY5_6269          CDS       T05416                                  Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism sfk  Streptomyces formicae Pathway sfk00261   Monobactam biosynthesis sfk01100   Metabolic pathways sfk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KY5_6269  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sfk01008]     KY5_6269 Polyketide biosynthesis proteins [BR:sfk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KY5_6269 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF3256 Motif Other DBs NCBI-ProteinID:  ATL31287 UniProt:  A0A291QID6 LinkDB All DBs Position 7283204..7283419 Genome browser AA seq 71 aa AA seqDB search MTNPFENDDAPYLVLVNDENQHSLWPVFVDVPEGWRSVFGEAARKDCLDYIERNWSDMRP KSLVDAMDGSK NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccccttcgagaacgacgacgccccgtacctggtcctcgtgaacgacgagaac cagcactccctgtggcccgtgttcgtcgacgtgcccgagggctggcggtccgtcttcggc gaggccgcccgtaaggactgtctcgactacatcgagcggaactggagcgacatgcggccc aagagcctcgtcgacgccatggacgggagcaagtga

DBGET integrated database retrieval system