Streptomyces flavofungini: QUY26_01115 Help Entry QUY26_01115       CDS       T09698                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sfp  Streptomyces flavofungini Pathway sfp00261   Monobactam biosynthesis sfp01100   Metabolic pathways sfp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     QUY26_01115  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sfp01008]     QUY26_01115 Polyketide biosynthesis proteins [BR:sfp01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     QUY26_01115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH MC_hydratase Motif Other DBs NCBI-ProteinID:  WJV44261 LinkDB All DBs Position complement(238944..239156) Genome browser AA seq 70 aa AA seqDB search MSVTGDTPANPFDADGPTSTFVVLVNELRQHSLWPLFADVPDGWTVVYGPCPRAAALEWI TARDAGALAR NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtccgtgaccggcgacacccccgccaaccccttcgacgcggacggccccacgagcacc ttcgtcgtcctcgtcaacgaactgcggcagcactccctgtggccgctgttcgccgacgtg cccgacggctggacggtcgtgtacggcccctgcccgcgcgccgccgcgctggagtggatc accgcgcgtgacgccggggcgctcgcccggtga

DBGET integrated database retrieval system