Streptomyces flavofungini: QUY26_05435 Help Entry QUY26_05435       CDS       T09698                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sfp  Streptomyces flavofungini Pathway sfp00261   Monobactam biosynthesis sfp01100   Metabolic pathways sfp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     QUY26_05435  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sfp01008]     QUY26_05435 Polyketide biosynthesis proteins [BR:sfp01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     QUY26_05435 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WJV45027 LinkDB All DBs Position 1418969..1419193 Genome browser AA seq 74 aa AA seqDB search MSSNPFDDADGQFYVLVNDEEQHSLWPSFTEVPAGWRVVFGEAGRQECLDYVEQNWTDLR PKSLRDAMAADQAA NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgagcagcaacccgttcgacgacgcggatggccagttctacgtcttggtgaacgacgag gagcagcactccctgtggccgtcgttcaccgaggtccccgccggctggcgggtggtgttc ggcgaggccggccgccaggagtgcctggactacgtggagcagaactggaccgacctgcgg cccaagagcctgcgcgacgcgatggccgccgaccaggccgcgtaa

DBGET integrated database retrieval system