Streptomyces flavofungini: QUY26_36965 Help Entry QUY26_36965       CDS       T09698                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sfp  Streptomyces flavofungini Pathway sfp00261   Monobactam biosynthesis sfp01100   Metabolic pathways sfp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     QUY26_36965  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sfp01008]     QUY26_36965 Polyketide biosynthesis proteins [BR:sfp01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     QUY26_36965 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WJV50604 LinkDB All DBs Position complement(8520585..8520794) Genome browser AA seq 69 aa AA seqDB search MSNPFDDADGRFSVLVNDEGQHSLWPEFAEVPGGWTVTHGPADRQSCLDHVEANWTDLRP RSLREATRG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcaaccccttcgacgacgccgacggccggttctccgtactcgtcaacgacgagggc cagcacagcctgtggcccgagttcgccgaggtgccgggcggctggaccgtgacccatggc ccggccgaccggcagtcctgcctggaccacgtcgaggccaactggaccgatctgcgcccc aggagcctgcgcgaggccacgcgcggctga

DBGET integrated database retrieval system