Streptomyces fungicidicus: CNQ36_10360 Help Entry CNQ36_10360       CDS       T07133                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sfug  Streptomyces fungicidicus Pathway sfug00261   Monobactam biosynthesis sfug01100   Metabolic pathways sfug01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfug00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CNQ36_10360  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sfug01008]     CNQ36_10360 Polyketide biosynthesis proteins [BR:sfug01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CNQ36_10360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  AYL35809 UniProt:  A0A494UYU5 LinkDB All DBs Position complement(2313103..2313321) Genome browser AA seq 72 aa AA seqDB search MSTNPFEDNDARYLVLVNDEGQHSLWPAFAEVPAGWTVAHPEDSRQACLDYVNENWTDMR PLSLVRQMEGAE NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatcccttcgaggacaacgacgcccggtacctcgtgctggtcaacgacgag ggccagcactcgctgtggccggcgttcgccgaggtgccggcgggctggacggtggcgcac cccgaggacagccgtcaggcctgcctcgactacgtcaacgagaactggaccgacatgcgt ccgctcagcctggtgcgtcagatggaaggcgccgagtag

DBGET integrated database retrieval system