Streptomyces fungicidicus: CNQ36_33710 Help Entry CNQ36_33710       CDS       T07133                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sfug  Streptomyces fungicidicus Pathway sfug00261   Monobactam biosynthesis sfug01100   Metabolic pathways sfug01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sfug00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CNQ36_33710  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sfug01008]     CNQ36_33710 Polyketide biosynthesis proteins [BR:sfug01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CNQ36_33710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AYL40370 UniProt:  A0A494V126 LinkDB All DBs Position p1:complement(801175..801426) Genome browser AA seq 83 aa AA seqDB search MTQPDSTAGAGADAARPDTDEVYLVVRNDEEQYSIWRADREVPAGWHPEGRRGGRQECLD HIGEIWTDMRPLSLRRRLAGADA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgacgcaacccgactccacggccggcgcgggcgccgacgcggcccgtccggacaccgac gaggtctacctcgtggtgcgcaacgacgaggagcagtactcgatctggcgggcggaccgc gaggttccggccggttggcacccggaggggaggcggggcggccggcaggagtgcctggac cacatcggggagatctggacggacatgcgcccgctcagcctgcgtcgccggctggccggg gcagatgcctga

DBGET integrated database retrieval system