Streptomyces galilaeus: CP966_00670 Help Entry CP966_00670       CDS       T06932                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sgal  Streptomyces galilaeus Pathway sgal00261   Monobactam biosynthesis sgal01100   Metabolic pathways sgal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgal00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP966_00670  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgal01008]     CP966_00670 Polyketide biosynthesis proteins [BR:sgal01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP966_00670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEU63949 UniProt:  A0A5J6EJI2 LinkDB All DBs Position complement(145910..146122) Genome browser AA seq 70 aa AA seqDB search MSTNPFDDNEGRFLVLVNDEGQYSLWPSFAEVPGGWATAFPENTREACLDFVESHWTDLR PRSLAATADS NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaaccccttcgacgacaacgaaggacgattcctggtcctggtgaacgacgag ggtcagtactccctctggccgtccttcgccgaggtgcccggaggatgggcgaccgccttc cccgagaacacccgggaagcctgcctggacttcgtcgagtcccactggacggatctgcgc ccccgctccctggcggcgaccgcggacagctga

DBGET integrated database retrieval system