Streptomyces galilaeus: CP966_31785 Help Entry CP966_31785       CDS       T06932                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sgal  Streptomyces galilaeus Pathway sgal00261   Monobactam biosynthesis sgal01100   Metabolic pathways sgal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgal00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP966_31785  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgal01008]     CP966_31785 Polyketide biosynthesis proteins [BR:sgal01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP966_31785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEU69336 UniProt:  A0A5J6F096 LinkDB All DBs Position 7006761..7006970 Genome browser AA seq 69 aa AA seqDB search MTNPFDDPDANYYVLVNEEGQHSLWPIFADAPDGWKIAFGEAGRVECLDFIEKHWTDMRP KSLVEAMES NT seq 210 nt NT seq  +upstreamnt  +downstreamnt gtgacgaatccattcgacgaccccgatgccaactactacgtgttggtcaacgaagagggt cagcactccctttggccgatcttcgcggacgcacctgacggttggaagatcgcgttcggt gaggcgggtcgtgtggaatgcctcgacttcatcgagaagcactggaccgacatgcggccc aagagccttgtcgaggccatggagagttag

DBGET integrated database retrieval system