Streptomyces globisporus: WQO_01720 Help Entry WQO_01720         CDS       T04209                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism sgb  Streptomyces globisporus Pathway sgb00261   Monobactam biosynthesis sgb01100   Metabolic pathways sgb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     WQO_01720  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgb01008]     WQO_01720 Polyketide biosynthesis proteins [BR:sgb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     WQO_01720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ALU92189 UniProt:  A0A0U3JZ98 LinkDB All DBs Position 431406..431612 Genome browser AA seq 68 aa AA seqDB search MTNPFDDPNTQHRVLVNDEGQHALWPSFAPVPAGWDEVFGPAGHTACLEYVEVHWPDITP RSARARVA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgacgaaccccttcgacgaccccaacacccagcaccgcgtcctggtcaacgacgagggc cagcacgccctgtggccgtcgttcgcgccggttcccgccggctgggacgaggtcttcggt ccggcagggcacacggcctgcctggagtacgtggaggtccactggcccgacatcacgccc aggagcgcccgcgcgcgggtggcatga

DBGET integrated database retrieval system