Selenobaculum gbiensis: P3F81_11920 Help Entry P3F81_11920       CDS       T09332                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism sgbi  Selenobaculum gbiensis Pathway sgbi00020   Citrate cycle (TCA cycle) sgbi01100   Metabolic pathways sgbi01110   Biosynthesis of secondary metabolites sgbi01120   Microbial metabolism in diverse environments sgbi01200   Carbon metabolism sgbi01210   2-Oxocarboxylic acid metabolism Module sgbi_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:sgbi00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     P3F81_11920 Enzymes [BR:sgbi01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      P3F81_11920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_10 Fer4_6 Fer4_9 Fer4_21 Fer4_4 Fer4_16 Fer4_8 Fer4_17 Fer4_15 Fer4_3 Fer4_13 Fer4_22 Fer4_18 Motif Other DBs NCBI-ProteinID:  WIW70575 UniProt:  A0A9Y2AJH8 LinkDB All DBs Position complement(2506967..2507173) Genome browser AA seq 68 aa AA seqDB search MSVSITIKEARCKGCKICVTFCPKAVLALDTLGKVQVVNAEACIACGLCELRCPDYAIYI DKKVNANE NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgagcgtatctataacgattaaagaagcaagatgtaaaggttgcaagatttgtgtaact ttttgccctaaagctgtattagctttagatacattaggcaaagtgcaagtggtaaatgct gaggcatgcattgcttgtggtttgtgtgaattacgttgtccagattatgcgatttatata gataagaaggtgaatgcaaatgagtaa

DBGET integrated database retrieval system