Streptomyces griseoviridis: ELQ87_35735 Help Entry ELQ87_35735       CDS       T06660                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sgd  Streptomyces griseoviridis Pathway sgd00261   Monobactam biosynthesis sgd01100   Metabolic pathways sgd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     ELQ87_35735  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgd01008]     ELQ87_35735 Polyketide biosynthesis proteins [BR:sgd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     ELQ87_35735 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AZS88999 UniProt:  A0A3Q9KYI5 LinkDB All DBs Position 8125676..8125894 Genome browser AA seq 72 aa AA seqDB search MANPFDDENGVFRVLVNDEGQYSLWPDFAPVPAGWNDVHGPDTRAACLDHIERNWTDMRP RGLAEAMRGTGA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggccaaccccttcgacgacgagaacggcgtcttccgcgtgctggtcaacgacgagggc cagtactcgctgtggccggacttcgcgcccgtcccggccggctggaacgacgtccacggc cccgacacccgggccgcctgcctcgatcacatcgagcggaactggacggacatgcgcccg cgcggcctcgccgaggcgatgcgcgggaccggggcgtga

DBGET integrated database retrieval system