Streptomyces griseofuscus: HEP81_00458 Help Entry HEP81_00458       CDS       T07010                                  Name (GenBank) hypothetical protein   KO K16937   thiosulfate dehydrogenase (quinone) large subunit [EC:1.8.5.2] Organism sgf  Streptomyces griseofuscus Pathway sgf00920   Sulfur metabolism sgf01100   Metabolic pathways sgf01120   Microbial metabolism in diverse environments Brite KEGG Orthology (KO) [BR:sgf00001]  09100 Metabolism   09102 Energy metabolism    00920 Sulfur metabolism     HEP81_00458 Enzymes [BR:sgf01000]  1. Oxidoreductases   1.8  Acting on a sulfur group of donors    1.8.5  With a quinone or similar compound as acceptor     1.8.5.2  thiosulfate dehydrogenase (quinone)      HEP81_00458 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  QNT90794 UniProt:  A0A7H1PRW4 LinkDB All DBs Position complement(486555..486830) Genome browser AA seq 91 aa AA seqDB search MPEGTRTALAVSAGIDTHTRRARALASPRILTGFVFLWAFLDKTFGLGYATASGNAWIDG MSPTPPRGRPRRPNIGEPPTRTGPFRNPVGP NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgccagaggggaccagaaccgcgctcgccgtgtcggcaggcatcgacacgcacaccagg cgggcgcgcgctctcgcgtccccgcgcatcctgaccgggttcgtcttcctgtgggcgttc ctcgacaagaccttcggcctcgggtacgccacggcgtccggcaatgcctggatcgacggg atgtccccgacgccgccccgaggccgaccgcgccgcccgaatatcggcgaaccccccaca cggacagggccattcaggaaccctgtcggaccatga

DBGET integrated database retrieval system