Streptomyces griseofuscus: HEP81_00815 Help Entry HEP81_00815       CDS       T07010                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism sgf  Streptomyces griseofuscus Pathway sgf00261   Monobactam biosynthesis sgf01100   Metabolic pathways sgf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HEP81_00815  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgf01008]     HEP81_00815 Polyketide biosynthesis proteins [BR:sgf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HEP81_00815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QNT91149 UniProt:  A0A7H1PSW9 LinkDB All DBs Position 910892..911143 Genome browser AA seq 83 aa AA seqDB search MTQPNSANGSGGDEARPGVEDGYLVVRNDEEQYSIWRADRELPAGWHREGHEGSRQECLD HIDAVWTDMRPLSLRRRLAGADV NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgacgcaacccaactccgcgaacggcagcggcggcgacgaggcgcgccccggcgtcgag gacgggtatctcgtggtgcgcaacgacgaggagcagtactcgatctggcgggcggaccgc gagctgccggccggctggcaccgggagggccacgagggcagcaggcaggagtgcctggac cacatcgacgccgtctggacggacatgcgcccgctgagcctgcgccgccggctcgccggg gccgatgtctga

DBGET integrated database retrieval system