Streptomyces griseofuscus: HEP81_01304 Help Entry HEP81_01304       CDS       T07010                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sgf  Streptomyces griseofuscus Pathway sgf00261   Monobactam biosynthesis sgf01100   Metabolic pathways sgf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HEP81_01304  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgf01008]     HEP81_01304 Polyketide biosynthesis proteins [BR:sgf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HEP81_01304 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QNT91635 UniProt:  A0A7H1PUA5 LinkDB All DBs Position 1480062..1480286 Genome browser AA seq 74 aa AA seqDB search MSNPFENDNADYLVVRNDELQHALWPATVAVPAGWTRVHGPAPRQNCLDHVERNWTDMRP ASLVAALAGNTARD NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgagcaaccccttcgagaacgacaacgccgactacctggtcgtccgcaacgacgagctc cagcacgccctgtggcccgccaccgtggccgtcccggccgggtggacgcgggtgcacggg cccgcgccgcggcagaactgcctcgaccacgtggagcggaactggaccgacatgcggccc gcgtccctggtggccgccctcgccgggaacacggcccgtgactga

DBGET integrated database retrieval system