Streptomyces griseofuscus: HEP81_01749 Help Entry HEP81_01749       CDS       T07010                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sgf  Streptomyces griseofuscus Pathway sgf00261   Monobactam biosynthesis sgf01100   Metabolic pathways sgf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HEP81_01749  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgf01008]     HEP81_01749 Polyketide biosynthesis proteins [BR:sgf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HEP81_01749 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QNT92078 UniProt:  A0A426SC77 LinkDB All DBs Position complement(1958883..1959095) Genome browser AA seq 70 aa AA seqDB search MATNPFEDPEGRYVVLANDEGQHSLWPVGIQQPAGWTLVRDEGTKQECAEYIEANWTDLR PKSAVAAMGG NT seq 213 nt NT seq  +upstreamnt  +downstreamnt gtggcaaccaacccttttgaggatccggaaggccgctacgtcgtactcgccaacgacgag ggccagcactccctctggccggtcggcatccagcagcccgcgggctggacgctggtgcgg gacgagggcacgaagcaggaatgcgccgagtacatcgaggccaactggacagacctgcgc cccaaatcggccgtcgcggccatgggcggctga

DBGET integrated database retrieval system