Streptomyces griseofuscus: HEP81_06657 Help Entry HEP81_06657       CDS       T07010                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sgf  Streptomyces griseofuscus Pathway sgf00261   Monobactam biosynthesis sgf01100   Metabolic pathways sgf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HEP81_06657  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgf01008]     HEP81_06657 Polyketide biosynthesis proteins [BR:sgf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HEP81_06657 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QNT96892 UniProt:  A0A7H1Q9B2 LinkDB All DBs Position 7256831..7257028 Genome browser AA seq 65 aa AA seqDB search MSNPFEKEDGKYVVLRNEAGQHSMWPNFIEVPAGWTVVHGEDTRQSCLDYVERSWTDMKP LAPVE NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgtcgaacccctttgagaaggaagacggaaagtacgtcgtcctgcgcaacgaggctggg cagcactcgatgtggcccaacttcatcgaggtacccgccggttggacggtcgtgcacggc gaggacacccgccagagctgcctcgactacgtcgagcgctcctggaccgacatgaagccg ctcgccccggtcgagtaa

DBGET integrated database retrieval system