Streptomyces griseofuscus: HEP81_07990 Help Entry HEP81_07990       CDS       T07010                                  Name (GenBank) hypothetical protein   KO K08968   L-methionine (R)-S-oxide reductase [EC:1.8.4.14] Organism sgf  Streptomyces griseofuscus Pathway sgf00270   Cysteine and methionine metabolism sgf01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:sgf00001]  09100 Metabolism   09105 Amino acid metabolism    00270 Cysteine and methionine metabolism     HEP81_07990 Enzymes [BR:sgf01000]  1. Oxidoreductases   1.8  Acting on a sulfur group of donors    1.8.4  With a disulfide as acceptor     1.8.4.14  L-methionine (R)-S-oxide reductase      HEP81_07990 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  QNT98218 UniProt:  A0A7H1QD38 LinkDB All DBs Position pSGRIFU1:complement(180467..180736) Genome browser AA seq 89 aa AA seqDB search MGRAACGPVQGERRQGVRGRAKRQGLQKDLRALAANIRADAEGRYDSAEPGWRSGVEWAL LWIENTASHLTEGRPGAGAGGRGQGVSPE NT seq 270 nt NT seq  +upstreamnt  +downstreamnt gtgggccgggcggcctgcggcccggtgcagggcgagcgccggcagggcgtcaggggcagg gccaagcggcagggattgcagaaggacctgcgggccctcgcggccaacatccgcgccgat gccgagggccggtacgacagcgcggagcctgggtggcgctccggtgtcgagtgggcgctg ctgtggatcgagaacaccgccagccatctgaccgagggcaggccgggcgccggggccggc ggccggggtcagggcgtgtcgccggagtag

DBGET integrated database retrieval system