Streptomyces genisteinicus: IAG43_01635 Help Entry IAG43_01635       CDS       T07903                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sgj  Streptomyces genisteinicus Pathway sgj00261   Monobactam biosynthesis sgj01100   Metabolic pathways sgj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgj00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     IAG43_01635  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgj01008]     IAG43_01635 Polyketide biosynthesis proteins [BR:sgj01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     IAG43_01635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QNP61753 UniProt:  A0A7H0HMI7 LinkDB All DBs Position complement(357350..357562) Genome browser AA seq 70 aa AA seqDB search MTATNPFEDPQGRFLVLVNDENQHSLWPVFAEIPPGWRTVFGEDTREACLSYVETHWTDL RPASLVARMS NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgaccgccaccaacccgttcgaggacccgcagggccgcttcctcgtgctcgtcaacgac gagaaccagcactcgctgtggcccgtgttcgccgagatcccgcccggctggcgcaccgtg ttcggcgaggacacccgcgaggcctgcctgtcctacgtggagacccactggacggacctg cgcccggcgagcctggtcgcccgcatgtcctga

DBGET integrated database retrieval system