Streptomyces genisteinicus: IAG43_30910 Help Entry IAG43_30910       CDS       T07903                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sgj  Streptomyces genisteinicus Pathway sgj00261   Monobactam biosynthesis sgj01100   Metabolic pathways sgj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgj00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     IAG43_30910  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgj01008]     IAG43_30910 Polyketide biosynthesis proteins [BR:sgj01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     IAG43_30910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QNP66899 UniProt:  A0A7H0I283 LinkDB All DBs Position complement(7226491..7226700) Genome browser AA seq 69 aa AA seqDB search MTTNPFEDTQGRFLVLVNEENQHSLWPAFAEVPAGWRTVFGEDTREACLAYVEQHWTDLR PASLVARQG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgacgaccaacccgttcgaggacacgcagggacgcttcctggtgctggtcaacgaggag aaccagcactccctctggcccgccttcgcggaggtccccgccggatggcgcacggtcttc ggcgaggacacgcgtgaggcctgcctcgcgtacgtcgagcagcactggaccgatctgcgc cccgccagtctggtcgcccggcagggctga

DBGET integrated database retrieval system