Streptomyces goshikiensis: PET44_35005 Help Entry PET44_35005       CDS       T09307                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sgk  Streptomyces goshikiensis Pathway sgk00261   Monobactam biosynthesis sgk01100   Metabolic pathways sgk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PET44_35005  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgk01008]     PET44_35005 Polyketide biosynthesis proteins [BR:sgk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PET44_35005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WBY24887 LinkDB All DBs Position punmamed2:complement(98908..99129) Genome browser AA seq 73 aa AA seqDB search MTNPFDSDGADPARKAFLVLVNTIGQHSLWPAHLETPAGWPVALGPARRAECMDFISRRP SPHRLTTALPAAA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacgaacccgttcgacagcgacggcgcggaccccgcgcgcaaggcgttcctcgtgctc gtcaacacgatcggccagcactcgctgtggccggcccacctggagacgcccgccggctgg cccgtcgcgctcggtccggcccggcgcgcggagtgcatggacttcatcagccgccgcccg agcccgcaccgcctcaccaccgcgctgcccgccgccgcctga

DBGET integrated database retrieval system