Streptomyces aurantiacus: GCM10017557_10650 Help Entry GCM10017557_10650 CDS       T07085                                  Symbol mbtH Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism sgm  Streptomyces aurantiacus Pathway sgm00261   Monobactam biosynthesis sgm01100   Metabolic pathways sgm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgm00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     GCM10017557_10650 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgm01008]     GCM10017557_10650 (mbtH) Polyketide biosynthesis proteins [BR:sgm01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     GCM10017557_10650 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCL26206 UniProt:  A0A7G1NXE3 LinkDB All DBs Position complement(1206947..1207195) Genome browser AA seq 82 aa AA seqDB search MSTNPFENPEGTYSVLVNDEGQYSLWPDFVDVPAGWTVAHGPAARQECLDHIEATWTDMR PKSLVERMAQTATGTGTGTGTA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaacccgttcgagaaccccgagggcacctactccgtgctcgtcaacgacgag ggccagtacagcctgtggcccgacttcgtggacgtgccggccggctggaccgtcgcgcac ggaccggctgcccgccaggagtgcctggaccacatcgaggccacctggacggacatgcgc cccaagagcctggtggagcggatggcccagacggcgacggggacggggacggggacgggg acggcgtga

DBGET integrated database retrieval system