Streptomyces griseus: SGR_3256 Help Entry SGR_3256          CDS       T00691                                  Name (GenBank) putative MbtH-like protein   KO K05375   MbtH protein Organism sgr  Streptomyces griseus Pathway sgr00261   Monobactam biosynthesis sgr01100   Metabolic pathways sgr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SGR_3256  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgr01008]     SGR_3256 Polyketide biosynthesis proteins [BR:sgr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SGR_3256 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BAG20085 Kitasato:  SGR3256 UniProt:  B1VL57 LinkDB All DBs Position complement(3779673..3779891) Genome browser AA seq 72 aa AA seqDB search MANPFEDDNAEYYVLVNDEGQYSIWPVFARIPEGWKTVHGAASRQECLDHVNENWTDMRP RSLAEAMTSQSA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggccaatccattcgaggatgacaatgccgagtactacgtgctcgtgaacgacgagggg cagtattcgatctggcccgtgttcgcccggattccggagggctggaaaacggtgcacggt gcggcctcccgtcaggagtgcctcgaccacgtgaacgagaactggaccgatatgcgtccg cgcagtctcgccgaggccatgacgtcccagtccgcctga

DBGET integrated database retrieval system