Streptomyces griseus: SGR_912 Help Entry SGR_912           CDS       T00691                                  Name (GenBank) putative MbtH-like protein   KO K05375   MbtH protein Organism sgr  Streptomyces griseus Pathway sgr00261   Monobactam biosynthesis sgr01100   Metabolic pathways sgr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SGR_912  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgr01008]     SGR_912 Polyketide biosynthesis proteins [BR:sgr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SGR_912 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BAG17741 Kitasato:  SGR912 UniProt:  B1VT37 LinkDB All DBs Position 1084139..1084366 Genome browser AA seq 75 aa AA seqDB search MAETTNPFDDDEAPFRVLRNDEDQHSLWPEFAPVPTGWHVVHGPDGRAACLAYVEEHWTD LRPASLRRAMDGPTG NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggctgagacgaccaacccgttcgacgacgacgaggcgccgttccgggtgctgcgcaac gacgaggaccagcactcgctgtggccggagttcgctccggtgcccaccgggtggcacgtg gtgcacggcccggacggccgggcggcgtgcctggcgtacgtcgaggagcactggaccgac ctgcgtccggcctccctgcgccgcgccatggacggcccgaccgggtga

DBGET integrated database retrieval system