Schistocerca gregaria (desert locust): 126281415 Help Entry 126281415         CDS       T08688                                  Name (RefSeq) GTPase HRas-like   KO K07827   GTPase KRas Organism sgre  Schistocerca gregaria (desert locust) Pathway sgre04013   MAPK signaling pathway - fly sgre04068   FoxO signaling pathway sgre04137   Mitophagy - animal sgre04140   Autophagy - animal sgre04150   mTOR signaling pathway sgre04213   Longevity regulating pathway - multiple species sgre04214   Apoptosis - fly sgre04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:sgre00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     126281415    04068 FoxO signaling pathway     126281415    04150 mTOR signaling pathway     126281415  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     126281415    04137 Mitophagy - animal     126281415   09143 Cell growth and death    04214 Apoptosis - fly     126281415  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     126281415   09149 Aging    04213 Longevity regulating pathway - multiple species     126281415  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sgre04131]     126281415   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:sgre04031]     126281415 Membrane trafficking [BR:sgre04131]  Endocytosis   Macropinocytosis    Ras GTPases     126281415 GTP-binding proteins [BR:sgre04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     126281415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase Septin FeoB_N Motif Other DBs NCBI-GeneID:  126281415 NCBI-ProteinID:  XP_049836309 LinkDB All DBs Position 7:276467010..276475945 Genome browser AA seq 190 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDL PSWVVDTNQAREIAKQYGIPFVETSAKTRMGVDDAFYTLVREIRKDKEHRGREKRKRLRG THKKKRCCLL NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atgactgaatacaaactggttgttgtgggtgcgggtggcgttgggaaaagtgcattgaca attcaacttatacaaaatcattttgtggacgaatatgatcctacaatagaagattcttat cggaaacaggttgtgattgacggagagacgtgtttgttagacatattggacacagcaggt caagaagaatatagtgctatgagagaccaatatatgaggactggtgaaggttttctttta gttttcgcagttaacagtgcaaaatcctttgaagatattggaacttatcgcgagcagatc aaaagggttaaagatgcagaagaagtcccgatggtattagttgggaataagtgcgaccta ccatcgtgggtagttgatacaaatcaagcacgcgaaatagccaagcagtatggaatcccc ttcgtcgaaacatcagcaaaaacacgtatgggtgttgacgacgcattctatacccttgta cgagaaatcagaaaagataaggagcacagaggacgagaaaaacgaaaaagattgagagga acccacaaaaagaagagatgctgtttgctgtag

DBGET integrated database retrieval system