Streptomyces graminofaciens: SGFS_005950 Help Entry SGFS_005950       CDS       T09325                                  Name (GenBank) uncharacterized protein   KO K05375   MbtH protein Organism sgrf  Streptomyces graminofaciens Pathway sgrf00261   Monobactam biosynthesis sgrf01100   Metabolic pathways sgrf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgrf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SGFS_005950  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgrf01008]     SGFS_005950 Polyketide biosynthesis proteins [BR:sgrf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SGFS_005950 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BBC29301 LinkDB All DBs Position 689916..690137 Genome browser AA seq 73 aa AA seqDB search MMNRMSNPFEDPEGVYLVLVNDENQHSLWPDFVEVPAGWRMVHGPASRQSCLEHVETNWT DMRPRSLAEAMDG NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatgaaccgtatgagcaacccgttcgaggaccccgagggcgtctacctggtgctcgtc aacgacgagaaccagcacagcctctggccggacttcgtggaggtgccggccggctggcgg atggtccacgggcccgcctcgcggcagtcctgcctggagcacgtcgagacgaactggacc gacatgcggccgcggagcctggcggaggcgatggacggctga

DBGET integrated database retrieval system