Serratia grimesii: SGBXF1_03504 Help Entry SGBXF1_03504      CDS       T09948                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism sgri  Serratia grimesii Pathway sgri00261   Monobactam biosynthesis sgri01100   Metabolic pathways sgri01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgri00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SGBXF1_03504  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgri01008]     SGBXF1_03504 Polyketide biosynthesis proteins [BR:sgri01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SGBXF1_03504 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  SMZ57852 LinkDB All DBs Position 1:complement(3687263..3687469) Genome browser AA seq 68 aa AA seqDB search METLNPFDDEQQICLIVQNDEQQYSLWPDFSAVPAGWTPVFGPAARSQCVNWLEKHWQDM RPASLRKA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggaaactctgaacccgttcgatgacgagcaacaaatctgcctgattgtgcagaatgac gaacaacaatacagcctgtggccggattttagcgcagtaccggcggggtggacgccggta ttcggcccggcagcacgatcacagtgtgtgaactggctggaaaagcattggcaggatatg cggcccgcatcactgcgtaaggcgtga

DBGET integrated database retrieval system