Streptomyces griseochromogenes: AVL59_10800 Help Entry AVL59_10800       CDS       T04729                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism sgs  Streptomyces griseochromogenes Pathway sgs00261   Monobactam biosynthesis sgs01100   Metabolic pathways sgs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgs00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AVL59_10800  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgs01008]     AVL59_10800 Polyketide biosynthesis proteins [BR:sgs01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AVL59_10800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ANP50034 UniProt:  A0A1B1ATY2 LinkDB All DBs Position 2504626..2504841 Genome browser AA seq 71 aa AA seqDB search MSTNPFDDEDGRFYVVINDEEQHSLWPVFAEVPAGWRVVFGEAARAECLEYVEQNWTDMR PKSLQEAMAAD NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgagcacgaacccctttgacgacgaggacggccgcttctacgtcgtgatcaacgatgag gagcagcactccctgtggccggtgttcgccgaggtgcccgcgggctggcgggtggtcttc ggcgaggcggccagggccgagtgcctggagtacgtcgagcagaactggaccgacatgcgt ccgaagagcctgcaggaggccatggcggcggactga

DBGET integrated database retrieval system