Streptomyces glaucescens: SGLAU_04490 Help Entry SGLAU_04490       CDS       T03327                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism sgu  Streptomyces glaucescens Pathway sgu00261   Monobactam biosynthesis sgu01100   Metabolic pathways sgu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SGLAU_04490  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgu01008]     SGLAU_04490 Polyketide biosynthesis proteins [BR:sgu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SGLAU_04490 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIR96924 UniProt:  A0A089X789 LinkDB All DBs Position complement(1039740..1039967) Genome browser AA seq 75 aa AA seqDB search MPNPFDDDSREFLALCNAEEQYSLWPQDIAVPEGWRAVYGPAAREEVIGYIDRTWTDMRP KSLRDAMARNDGLPA NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgcccaatccattcgacgacgacagccgggaattcctcgccctgtgcaacgccgaggag cagtactcgctgtggccgcaggacatcgccgtccccgagggctggcgggccgtgtacggt cccgcggcccgggaggaggtgatcggctacatcgaccggacgtggacggacatgcggccg aaaagcctgcgggacgcgatggcccgcaacgacggactgccggcgtga

DBGET integrated database retrieval system