Streptomyces glaucescens: SGLAU_31240 Help Entry SGLAU_31240       CDS       T03327                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism sgu  Streptomyces glaucescens Pathway sgu00261   Monobactam biosynthesis sgu01100   Metabolic pathways sgu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SGLAU_31240  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgu01008]     SGLAU_31240 Polyketide biosynthesis proteins [BR:sgu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SGLAU_31240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Lpp-LpqN Motif Other DBs NCBI-ProteinID:  AIS02182 UniProt:  A0A089XJM1 LinkDB All DBs Position 7153681..7153884 Genome browser AA seq 67 aa AA seqDB search MDENTRYQVLRNDEEQYSLWPVDIEVPAGWQPVGKEGTEAECSAYVDEVWTDMRPRSLRE RMENAEA NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggacgagaacacccgctaccaggtgctgcgcaacgacgaggagcagtactcgctgtgg cccgtcgacatcgaggtgcccgccggctggcagccggtcggcaaggagggcacggaggcc gagtgctccgcctacgtcgacgaggtctggaccgacatgcgcccgcgcagcctgcgtgag cgcatggagaacgccgaagcctga

DBGET integrated database retrieval system