Streptomyces gardneri: H4W23_35870 Help Entry H4W23_35870       CDS       T07252                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sgx  Streptomyces gardneri Pathway sgx00261   Monobactam biosynthesis sgx01100   Metabolic pathways sgx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgx00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     H4W23_35870  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgx01008]     H4W23_35870 Polyketide biosynthesis proteins [BR:sgx01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     H4W23_35870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QPK49453 LinkDB All DBs Position 7922819..7923022 Genome browser AA seq 67 aa AA seqDB search MDGDTQSYVVVLNDEEQYSIWPADRDLPLGWRGDGVSGSREECLAHIGEAWTDMRPSSLR QAGQTGF NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggacggcgacacccagtcctatgtggtcgtactcaacgacgaggagcagtactcgatc tggccggccgaccgtgacctgccgctcggctggcgcggtgacggcgtcagcggttccagg gaggaatgcctggcccacatcggcgaggcctggacggacatgcgtccgtcgagcttacgc caggccggccagaccggtttctag

DBGET integrated database retrieval system