Streptomyces gardneri: H4W23_36120 Help Entry H4W23_36120       CDS       T07252                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sgx  Streptomyces gardneri Pathway sgx00261   Monobactam biosynthesis sgx01100   Metabolic pathways sgx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgx00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     H4W23_36120  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgx01008]     H4W23_36120 Polyketide biosynthesis proteins [BR:sgx01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     H4W23_36120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QPK49499 LinkDB All DBs Position 7991472..7991687 Genome browser AA seq 71 aa AA seqDB search MTTNPFENADAEYLVLVNHENQHSLWPADIEVPDGWTAVHGAASRQACLDYVDTYWTDMR PASLIAETAAG NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgaccaccaatccctttgagaacgcggacgccgaatacctggtcctcgtcaatcacgag aaccagcattcgctgtggccggccgacatcgaggtcccggacggctggaccgccgtccac ggagccgcctcccgacaggcctgcctcgactacgtcgacacctactggaccgacatgcgc ccggcgagcctgatcgccgagaccgccgccggctga

DBGET integrated database retrieval system