Streptomyces globosus: C0216_09205 Help Entry C0216_09205       CDS       T06864                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sgz  Streptomyces globosus Pathway sgz00261   Monobactam biosynthesis sgz01100   Metabolic pathways sgz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgz00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     C0216_09205  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgz01008]     C0216_09205 Polyketide biosynthesis proteins [BR:sgz01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     C0216_09205 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AXE23615 UniProt:  A0A344TY94 LinkDB All DBs Position 2006367..2006576 Genome browser AA seq 69 aa AA seqDB search MSETDDGRYLVVRNDEEQYSIWRADRELPAGWHAEGASGTRQECLDHIGRVWTDMRPLSL RRRLAEADA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcgagaccgacgacggccgctacctggtcgtgcgcaacgacgaggagcagtactcc atctggcgggcggaccgggagctccccgcgggctggcacgccgagggcgcgtccggcacc cggcaggagtgcctggaccacatcggccgggtgtggacggacatgcggccgctgagcctg cgccgccgcctggccgaggcggacgcctga

DBGET integrated database retrieval system