Streptomyces harbinensis: HUT13_00985 Help Entry HUT13_00985       CDS       T07389                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism shar  Streptomyces harbinensis Pathway shar00261   Monobactam biosynthesis shar01100   Metabolic pathways shar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shar00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HUT13_00985  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:shar01008]     HUT13_00985 Polyketide biosynthesis proteins [BR:shar01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HUT13_00985 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QKV67499 UniProt:  A0A1I6R3D2 LinkDB All DBs Position complement(250544..250765) Genome browser AA seq 73 aa AA seqDB search MTNPFDDPEGRFLVLVNDEGQHSLWPAFADVPEGWETAHPEDTREACLAYIEKNWTDMRP LSLVRAMEDSATS NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccgttcgacgaccccgagggccgcttcctggtgctggtcaacgacgagggg cagcactccctctggccggcgttcgcggatgttcccgagggctgggagaccgcccacccg gaggacacccgtgaggcgtgcctcgcctacatcgagaagaactggaccgacatgcgtccc ctgagtctggtgagggcgatggaggattccgccacgtcctga

DBGET integrated database retrieval system