Shewanella sp. MR-4: Shewmr4_2902 Help Entry Shewmr4_2902      CDS       T00388                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism she  Shewanella sp. MR-4 Pathway she00790   Folate biosynthesis she01100   Metabolic pathways she01240   Biosynthesis of cofactors Module she_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:she00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Shewmr4_2902 Enzymes [BR:she01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Shewmr4_2902  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Shewmr4_2902  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Shewmr4_2902 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ABI39973 LinkDB All DBs Position complement(3464314..3464664) Genome browser AA seq 116 aa AA seqDB search MDKVLIRQLRIDTVIGVYEWEKKIQQSLFLDLDMAWDNKAAAATDDYQYALCYETVSNRL TQLVTEKPIELIETVAERVAECLLSEFKVSWVKVVVMKPGAVPSASAVGVEIERSR NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggataaagtgcttattcgacaattacgtattgatactgtgattggcgtctatgaatgg gaaaagaaaatccagcaaagcctgtttttggatctcgacatggcttgggataataaggcc gccgcggcaaccgacgactatcaatacgccctctgctatgagacggtatctaatcgcctg actcaacttgtcaccgaaaagcctatcgagttaatcgaaaccgttgccgagcgggtcgcc gagtgcttactcagtgagtttaaggtgagttgggtcaaagtggtggtgatgaaacccgga gcagtgccttcagcctctgctgttggggtcgagattgagcgctcgcgttaa

DBGET integrated database retrieval system