Sphingobacterium sp. 21: Sph21_1748 Help Entry Sph21_1748        CDS       T01450                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism shg  Sphingobacterium sp. 21 Pathway shg00790   Folate biosynthesis shg01100   Metabolic pathways shg01240   Biosynthesis of cofactors Module shg_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:shg00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Sph21_1748 Enzymes [BR:shg01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Sph21_1748  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Sph21_1748  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Sph21_1748 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ADZ78310 UniProt:  F4C838 LinkDB All DBs Position 2123190..2123564 Genome browser AA seq 124 aa AA seqDB search MEQYKRKIALTNARFYAYHGYYHEEQMLGNEFFLDIICFVSNPTLNTDDNLVKTINYEEL YRIAKEEMAQPKKLLETVVDNILNSIKVNFHEVNEIEVSLRKSNPPFGGDAATAEVSLYW QSGA NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggagcaatataagagaaaaatagcactaacaaatgctcgtttttatgcttaccatggc tattatcacgaagagcagatgcttggaaacgagttttttttagatatcatttgctttgta agcaaccctacattgaatacggatgataatttggtgaaaacgatcaattacgaagagctt tatcgcattgctaaagaggagatggctcaaccgaaaaaactgttggaaacggttgtggat aacatactcaatagtattaaggtaaatttccatgaggtaaatgaaatagaggtatccctg agaaaaagtaatccgcctttcggtggagatgctgcaactgctgaagtaagtttatactgg caatcgggcgcttaa

DBGET integrated database retrieval system