Streptomyces huasconensis: J2N69_01040 Help Entry J2N69_01040       CDS       T07920                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism shk  Streptomyces huasconensis Pathway shk00261   Monobactam biosynthesis shk01100   Metabolic pathways shk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     J2N69_01040  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:shk01008]     J2N69_01040 Polyketide biosynthesis proteins [BR:shk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     J2N69_01040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  UFQ13713 LinkDB All DBs Position complement(230026..230238) Genome browser AA seq 70 aa AA seqDB search MTNPFENPDGRYVVLVNHEGQHSLWPVFAEVPDGWTVVHAEDSRQACLDYIEEHWTDMRP KSLIEQMGGR NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgacgaacccgttcgagaaccctgacggccggtatgttgtgctggtcaaccacgagggc cagcactcgctctggccggtcttcgccgaggtgccggacggctggacggtcgtccacgcg gaggacagccgccaggcctgcctcgactacatcgaggagcactggaccgacatgcggccc aagagcctcatcgagcagatgggcggccgatga

DBGET integrated database retrieval system