Streptomyces huasconensis: J2N69_34390 Help Entry J2N69_34390       CDS       T07920                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism shk  Streptomyces huasconensis Pathway shk00261   Monobactam biosynthesis shk01100   Metabolic pathways shk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:shk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     J2N69_34390  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:shk01008]     J2N69_34390 Polyketide biosynthesis proteins [BR:shk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     J2N69_34390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH MC_hydratase Motif Other DBs NCBI-ProteinID:  UFQ19652 LinkDB All DBs Position 7741827..7742036 Genome browser AA seq 69 aa AA seqDB search MSTNPFEDPQGTFLVLVNDENQHSLWPSFAEVPAGWRVVFGEDTREACLAHVEAHWTDMR PASLAAAQG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaacccgttcgaggacccgcagggcaccttcctggtcctggtcaacgacgag aaccagcactcgctgtggccgtccttcgcggaggtgcccgccggctggcgggtcgtcttc ggcgaggacacccgtgaggcctgcctggcccatgtggaggcccactggaccgacatgcgc cccgcgagcctggccgccgcgcagggctga

DBGET integrated database retrieval system