Segatella hominis: KUA50_008365 Help Entry KUA50_008365      CDS       T09571                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism shoi  Segatella hominis Pathway shoi00020   Citrate cycle (TCA cycle) shoi01100   Metabolic pathways shoi01110   Biosynthesis of secondary metabolites shoi01120   Microbial metabolism in diverse environments shoi01200   Carbon metabolism shoi01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:shoi00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     KUA50_008365 Enzymes [BR:shoi01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      KUA50_008365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_6 Fer4_21 Fer4_10 Fer4_9 Fer4_16 Fer4_4 Fer4_17 Fer4_13 Fer4_8 Fer4_22 Chordopox_G2 Fer4_15 Fer4_3 Motif Other DBs NCBI-ProteinID:  WOZ80095 LinkDB All DBs Position complement(2003775..2004008) Genome browser AA seq 77 aa AA seqDB search MSKIKGAIVVDTGRCKGCALCVVACPQHVIALAEKKVNVHGYRYVEAAVPDACVGCTSCA IVCPDGCITVYRKKENE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtaagattaaaggggctattgtagtcgatacagggcgctgcaagggatgtgcgctc tgtgtggtggcttgtcctcaacatgtcattgcattagccgagaaaaaagtaaatgtgcat ggttatcgctatgtggaagcggctgtgccggatgcatgcgtgggttgtacttcgtgcgcc atcgtatgccctgatggatgtattaccgtgtatcgtaagaaggagaatgaataa

DBGET integrated database retrieval system