Sturnira hondurensis: 118981894 Help Entry 118981894         CDS       T07222                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism shon  Sturnira hondurensis Pathway shon01523   Antifolate resistance shon04010   MAPK signaling pathway shon04060   Cytokine-cytokine receptor interaction shon04064   NF-kappa B signaling pathway shon04217   Necroptosis shon04380   Osteoclast differentiation shon04620   Toll-like receptor signaling pathway shon04621   NOD-like receptor signaling pathway shon04623   Cytosolic DNA-sensing pathway shon04625   C-type lectin receptor signaling pathway shon04640   Hematopoietic cell lineage shon04657   IL-17 signaling pathway shon04659   Th17 cell differentiation shon04668   TNF signaling pathway shon04750   Inflammatory mediator regulation of TRP channels shon04932   Non-alcoholic fatty liver disease shon04933   AGE-RAGE signaling pathway in diabetic complications shon04936   Alcoholic liver disease shon04940   Type I diabetes mellitus shon05010   Alzheimer disease shon05020   Prion disease shon05022   Pathways of neurodegeneration - multiple diseases shon05132   Salmonella infection shon05133   Pertussis shon05134   Legionellosis shon05135   Yersinia infection shon05140   Leishmaniasis shon05142   Chagas disease shon05143   African trypanosomiasis shon05144   Malaria shon05146   Amoebiasis shon05152   Tuberculosis shon05162   Measles shon05163   Human cytomegalovirus infection shon05164   Influenza A shon05168   Herpes simplex virus 1 infection shon05171   Coronavirus disease - COVID-19 shon05321   Inflammatory bowel disease shon05323   Rheumatoid arthritis shon05332   Graft-versus-host disease shon05417   Lipid and atherosclerosis shon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118981894 (IL1B)    04064 NF-kappa B signaling pathway     118981894 (IL1B)    04668 TNF signaling pathway     118981894 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118981894 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     118981894 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     118981894 (IL1B)    04620 Toll-like receptor signaling pathway     118981894 (IL1B)    04621 NOD-like receptor signaling pathway     118981894 (IL1B)    04623 Cytosolic DNA-sensing pathway     118981894 (IL1B)    04625 C-type lectin receptor signaling pathway     118981894 (IL1B)    04659 Th17 cell differentiation     118981894 (IL1B)    04657 IL-17 signaling pathway     118981894 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     118981894 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     118981894 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     118981894 (IL1B)    05164 Influenza A     118981894 (IL1B)    05162 Measles     118981894 (IL1B)    05168 Herpes simplex virus 1 infection     118981894 (IL1B)    05163 Human cytomegalovirus infection     118981894 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     118981894 (IL1B)    05135 Yersinia infection     118981894 (IL1B)    05133 Pertussis     118981894 (IL1B)    05134 Legionellosis     118981894 (IL1B)    05152 Tuberculosis     118981894 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     118981894 (IL1B)    05144 Malaria     118981894 (IL1B)    05140 Leishmaniasis     118981894 (IL1B)    05142 Chagas disease     118981894 (IL1B)    05143 African trypanosomiasis     118981894 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     118981894 (IL1B)    05321 Inflammatory bowel disease     118981894 (IL1B)    05332 Graft-versus-host disease     118981894 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     118981894 (IL1B)    05020 Prion disease     118981894 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     118981894 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118981894 (IL1B)    05418 Fluid shear stress and atherosclerosis     118981894 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     118981894 (IL1B)    04936 Alcoholic liver disease     118981894 (IL1B)    04932 Non-alcoholic fatty liver disease     118981894 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     118981894 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     118981894 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shon04052]     118981894 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:shon00536]     118981894 (IL1B) Cytokines and neuropeptides [BR:shon04052]  Cytokines   Interleukins    118981894 (IL1B) Glycosaminoglycan binding proteins [BR:shon00536]  Heparan sulfate / Heparin   Cytokines    118981894 (IL1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1_propep IL1 Motif Other DBs NCBI-GeneID:  118981894 NCBI-ProteinID:  XP_036894628 LinkDB All DBs Position Unknown AA seq 268 aa AA seqDB search MAAVPELASEMMACYSDNENDLFFEADGPQQTKCSFQNLDLSSLGDESIQLKVSHQLYNS SFRRVASVMVAVEKLRKVPIVCSQDFQDDDLRSLFFFIFKEEPIDSMWDDTYECDALLQS LNCRLRDINQKALVLSGPHELQALHLTRQNMNQGVVFCMKFVPGEENNDKIPVALGIKEK DLYLSCTMKDGKPTLQLETLDPTAQSKKKMEKRFVFNKTEMMGKVEFESALYPSWYISTS QAEQMPVFLGNVRGGQDITDFTLEILSS NT seq 807 nt NT seq  +upstreamnt  +downstreamnt atggcagcagtacctgaactcgccagtgaaatgatggcttgctacagtgacaatgagaat gacctgttctttgaggctgatggcccccaacagactaagtgctcttttcaaaacctggac ctcagctctctgggagacgagagcatccagctgaaggtctcccatcagctctacaactcg agtttcaggcgggtcgcgtcggtcatggttgcagtggagaagctgaggaaagtgcccatt gtctgctcacaggacttccaggatgacgacctcaggagcctcttcttcttcatctttaaa gaagaacccatcgacagcatgtgggatgacacttacgagtgcgatgcactcctacaatcg ctgaactgcagactccgtgacataaaccaaaaagccctggtgctgtctggaccgcatgag ctgcaggctcttcacctcactagacagaatatgaaccaaggagtggtgttctgcatgaaa tttgtgccaggagaagaaaataatgacaagattcctgtggccttgggcatcaaggaaaaa gacctgtacctctcttgcacgatgaaggacgggaagcccaccctgcaactggagacatta gatcccacagctcagtcaaagaagaagatggaaaagcgatttgtcttcaacaagacagaa atgatgggcaaagtagaatttgagtctgccctgtatcccagctggtacatcagcacctcg caagcagaacagatgcccgtcttcctaggaaatgttagagggggtcaggatataactgac ttcaccttggaaatcctgtcttcttga

DBGET integrated database retrieval system