Sarcophilus harrisii (Tasmanian devil): 100922350 Help Entry 100922350         CDS       T02286                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr01523   Antifolate resistance shr04010   MAPK signaling pathway shr04060   Cytokine-cytokine receptor interaction shr04064   NF-kappa B signaling pathway shr04217   Necroptosis shr04380   Osteoclast differentiation shr04620   Toll-like receptor signaling pathway shr04621   NOD-like receptor signaling pathway shr04623   Cytosolic DNA-sensing pathway shr04625   C-type lectin receptor signaling pathway shr04640   Hematopoietic cell lineage shr04657   IL-17 signaling pathway shr04659   Th17 cell differentiation shr04668   TNF signaling pathway shr04750   Inflammatory mediator regulation of TRP channels shr04932   Non-alcoholic fatty liver disease shr04933   AGE-RAGE signaling pathway in diabetic complications shr04936   Alcoholic liver disease shr04940   Type I diabetes mellitus shr05010   Alzheimer disease shr05020   Prion disease shr05022   Pathways of neurodegeneration - multiple diseases shr05132   Salmonella infection shr05133   Pertussis shr05134   Legionellosis shr05135   Yersinia infection shr05140   Leishmaniasis shr05142   Chagas disease shr05143   African trypanosomiasis shr05144   Malaria shr05146   Amoebiasis shr05152   Tuberculosis shr05162   Measles shr05163   Human cytomegalovirus infection shr05164   Influenza A shr05168   Herpes simplex virus 1 infection shr05171   Coronavirus disease - COVID-19 shr05321   Inflammatory bowel disease shr05323   Rheumatoid arthritis shr05332   Graft-versus-host disease shr05417   Lipid and atherosclerosis shr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100922350 (IL1B)    04064 NF-kappa B signaling pathway     100922350 (IL1B)    04668 TNF signaling pathway     100922350 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100922350 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100922350 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100922350 (IL1B)    04620 Toll-like receptor signaling pathway     100922350 (IL1B)    04621 NOD-like receptor signaling pathway     100922350 (IL1B)    04623 Cytosolic DNA-sensing pathway     100922350 (IL1B)    04625 C-type lectin receptor signaling pathway     100922350 (IL1B)    04659 Th17 cell differentiation     100922350 (IL1B)    04657 IL-17 signaling pathway     100922350 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100922350 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     100922350 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     100922350 (IL1B)    05164 Influenza A     100922350 (IL1B)    05162 Measles     100922350 (IL1B)    05168 Herpes simplex virus 1 infection     100922350 (IL1B)    05163 Human cytomegalovirus infection     100922350 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     100922350 (IL1B)    05135 Yersinia infection     100922350 (IL1B)    05133 Pertussis     100922350 (IL1B)    05134 Legionellosis     100922350 (IL1B)    05152 Tuberculosis     100922350 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     100922350 (IL1B)    05144 Malaria     100922350 (IL1B)    05140 Leishmaniasis     100922350 (IL1B)    05142 Chagas disease     100922350 (IL1B)    05143 African trypanosomiasis     100922350 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     100922350 (IL1B)    05321 Inflammatory bowel disease     100922350 (IL1B)    05332 Graft-versus-host disease     100922350 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     100922350 (IL1B)    05020 Prion disease     100922350 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     100922350 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100922350 (IL1B)    05418 Fluid shear stress and atherosclerosis     100922350 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100922350 (IL1B)    04936 Alcoholic liver disease     100922350 (IL1B)    04932 Non-alcoholic fatty liver disease     100922350 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     100922350 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     100922350 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shr04052]     100922350 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:shr00536]     100922350 (IL1B) Cytokines and neuropeptides [BR:shr04052]  Cytokines   Interleukins    100922350 (IL1B) Glycosaminoglycan binding proteins [BR:shr00536]  Heparan sulfate / Heparin   Cytokines    100922350 (IL1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1_propep IL1 Motif Other DBs NCBI-GeneID:  100922350 NCBI-ProteinID:  XP_003758660 Ensembl:  ENSSHAG00000008907 UniProt:  G3W4G1 LinkDB All DBs Position 2:35598714..35605647 Genome browser AA seq 273 aa AA seqDB search MAMVPEITCEEMDFYRDNEHQFYESDGPNQKKGNLQCLDLCPKESLLVEDDIQLKFTAQP HQFYRTVVVVVAIEKMKHLNKICSQFFQDNDLMNIFTTIFQEEPIVIENCDMYESDFPFP FAFSRDYTIQDINQKCLTLSNASELQALHLNGQNISQQVIFSMKYFLGEIGSQKTHVVLC IKKNNFYLSCVKRNGKPILQLEQVANFPSNNPDRRFIFNKTEINHKTEFESVEYPNWFIS TSQMDEQPVFLGNIRGGEDITNFILEDLSEMNS NT seq 822 nt NT seq  +upstreamnt  +downstreamnt atggctatggtacctgaaatcacttgtgaggagatggatttttacagggacaatgaacac caattttatgagtcagatggtcccaaccaaaagaagggtaatctccagtgtctggatctt tgccccaaggaaagtcttttggtagaggatgacatccagctgaaattcactgctcagcct catcaattctatcgaactgtggtggtagttgttgcaattgaaaagatgaagcatctcaac aaaatctgctcccagttcttccaggataatgatctgatgaatattttcacaaccatcttt caagaagaacccatagtcatcgagaactgtgatatgtatgagtctgacttcccctttcca tttgcattctcccgggattatactattcaagacataaatcaaaaatgccttaccttgtcc aatgccagtgaattgcaagctcttcatctcaatggacagaacataagccaacaagtaatt ttcagcatgaagtacttccttggtgagataggctcccagaaaacacatgttgtcctctgt atcaagaaaaataatttctatctgtcttgtgtgaagcgtaacgggaagcccattctacag ctagagcaagttgccaatttccccagcaataacccggacaggcgatttatcttcaacaag acagaaatcaatcataagactgaatttgagtctgtagaataccccaactggtttatcagc acctcccaaatggatgagcagcctgtcttcctgggaaacataagagggggcgaagacata actaacttcattttggaggatctctctgaaatgaactcttaa

DBGET integrated database retrieval system