Shinella sp. HZN7: shn_32570 Help Entry shn_32570         CDS       T04278                                  Name (GenBank) sarcosine oxidase subunit delta   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism shz  Shinella sp. HZN7 Pathway shz00260   Glycine, serine and threonine metabolism shz01100   Metabolic pathways Module shz_M00975   Betaine degradation, bacteria, betaine => pyruvate Brite KEGG Orthology (KO) [BR:shz00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     shn_32570 Enzymes [BR:shz01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      shn_32570     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      shn_32570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Lar_restr_allev Motif Other DBs NCBI-ProteinID:  ANH08873 UniProt:  A0A1A9GEY4 LinkDB All DBs Position pShin-08:69354..69638 Genome browser AA seq 94 aa AA seqDB search MQLFPCPFCGPRSESEFHFGGDAGNHRPEGFRAVTDGEWSNYLHARNNPRGAANEIWMHM TCGEVFRMERDTVHHRVARSFAPGEGDGHDGMAH NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgcagctctttccctgccccttctgcggcccgcgaagcgagagcgaattccatttcggc ggagatgccggcaaccatcgcccggaagggtttcgcgccgtgacggatggcgaatggagc aattacctccatgcacgcaacaatccgcgcggggcggcaaacgaaatctggatgcacatg acctgcggcgaggtcttccgcatggaacgggataccgtgcatcatcgcgtggcacggtcc ttcgcaccgggagagggagacggtcatgacggcatggcgcactga

DBGET integrated database retrieval system