Streptomyces inhibens: KI385_25360 Help Entry KI385_25360       CDS       T08140                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sine  Streptomyces inhibens Pathway sine00261   Monobactam biosynthesis sine01100   Metabolic pathways sine01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sine00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KI385_25360  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sine01008]     KI385_25360 Polyketide biosynthesis proteins [BR:sine01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KI385_25360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  UKY51811 LinkDB All DBs Position complement(5541434..5541649) Genome browser AA seq 71 aa AA seqDB search MGTNPFDDPDGRYLVLVNEEDQHSLWPAFAEVPQGWTVALAETDRQSALDFITEHWTDMR PRSLVRAMEEA NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgggcacaaaccccttcgacgaccccgacggccggtatctggtgctggtcaacgaggaa gaccagcattcactctggccggctttcgccgaggtgccccagggctggacggtggcgctc gcggaaaccgaccgtcagtccgcgctcgacttcatcaccgagcactggaccgacatgcgg ccgcgcagcctggtgcgggcgatggaagaggcttag

DBGET integrated database retrieval system