Streptomyces incarnatus: ABB07_24035 Help Entry ABB07_24035       CDS       T09785                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism sinn  Streptomyces incarnatus Pathway sinn00261   Monobactam biosynthesis sinn01100   Metabolic pathways sinn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sinn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     ABB07_24035  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sinn01008]     ABB07_24035 Polyketide biosynthesis proteins [BR:sinn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     ABB07_24035 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AKJ12991 UniProt:  A0A0G3AG93 LinkDB All DBs Position 5410863..5411057 Genome browser AA seq 64 aa AA seqDB search MPNPFDDPNGTYLVLADGKGHHSLWPAFADVPAGWAVVRHAGTRQECLDHIDHDPTDRPE HETA NT seq 195 nt NT seq  +upstreamnt  +downstreamnt gtgccgaaccccttcgacgacccgaacgggacctacctggtcctggccgacgggaaagga caccactcgctgtggccggccttcgccgacgtccccgccggctgggccgtcgtccgtcac gccggcacccgccaggagtgcctggaccacatcgaccacgacccgaccgacagaccggag cacgaaaccgcatga

DBGET integrated database retrieval system