Sulfurovum indicum: IMZ28_02155 Help Entry IMZ28_02155       CDS       T07193                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism sinu  Sulfurovum indicum Pathway sinu00790   Folate biosynthesis sinu01100   Metabolic pathways sinu01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:sinu00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     IMZ28_02155 Enzymes [BR:sinu01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      IMZ28_02155  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      IMZ28_02155  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      IMZ28_02155 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QOR62302 UniProt:  A0A7M1S5E6 LinkDB All DBs Position complement(414580..414906) Genome browser AA seq 108 aa AA seqDB search MTIHIEALAFDAIIGLLDFEQERPQRVVVDLKAGYDYIPGEFIDYADLATLIMEKVKQAH YKLLEDALLELETLILSTYPQITSLYLKISKPDILNNGTVALSHQWNY NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgacgatccatatcgaagcccttgcctttgatgctatcatcggactgcttgactttgaa caggagcgtccgcaacgagtagttgtagatcttaaagcaggttatgactatatacctggc gaattcatcgattatgccgatcttgcaacacttattatggaaaaagtaaaacaggcacat tataaactgcttgaggatgcccttttggagctggaaacactgattctctctacctaccct cagatcacctctctatatttgaagatcagtaaacctgatatcctgaacaacggaactgtt gcacttagtcaccagtggaattactga

DBGET integrated database retrieval system