Streptomyces kanamyceticus: CP970_25130 Help Entry CP970_25130       CDS       T06849                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ska  Streptomyces kanamyceticus Pathway ska00261   Monobactam biosynthesis ska01100   Metabolic pathways ska01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ska00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP970_25130  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ska01008]     CP970_25130 Polyketide biosynthesis proteins [BR:ska01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP970_25130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEU93749 UniProt:  A0A5J6GE16 LinkDB All DBs Position complement(5809687..5809866) Genome browser AA seq 59 aa AA seqDB search MTTSEAPANPFDADGEFLVLANERGELSLWPLFAAVPEGWSAQHGPCPRQDALDWVKSR NT seq 180 nt NT seq  +upstreamnt  +downstreamnt gtgacgacgagcgaagcccccgccaaccccttcgacgcggacggcgagttcctggtcctc gccaacgagcgcggcgagctctcgctgtggccgctcttcgccgccgtgcccgaaggatgg tcggcgcagcacggcccgtgcccgcgccaggacgccctggactgggtcaagtcccggtga

DBGET integrated database retrieval system