Skermanella sp. TT6: IGS68_31770 Help Entry IGS68_31770       CDS       T07020                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism skt  Skermanella sp. TT6 Pathway skt00261   Monobactam biosynthesis skt01100   Metabolic pathways skt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:skt00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     IGS68_31770  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:skt01008]     IGS68_31770 Polyketide biosynthesis proteins [BR:skt01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     IGS68_31770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QQP93604 LinkDB All DBs Position pTT6-2:complement(41354..41563) Genome browser AA seq 69 aa AA seqDB search MFDDDSVVFTVVINDEEQYSIWPEFKPVPQGWRAVGKTGTKAECLDHIREVWTDMRPASL RRRLAEAGA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgtttgacgacgactccgtcgttttcaccgtcgtgatcaacgacgaggagcagtattcc atctggccggagttcaagccggtgccccagggctggcgggcggtcggcaagaccggcacc aaggccgagtgcctggaccatatccgcgaggtatggaccgacatgaggccggccagcctg cggcggcgcctggccgaagccggcgcctga

DBGET integrated database retrieval system