Streptomyces koyangensis: D0C37_02200 Help Entry D0C37_02200       CDS       T06436                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sky  Streptomyces koyangensis Pathway sky00261   Monobactam biosynthesis sky01100   Metabolic pathways sky01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sky00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     D0C37_02200  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sky01008]     D0C37_02200 Polyketide biosynthesis proteins [BR:sky01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     D0C37_02200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AXQ53541 UniProt:  A0A385D6L0 LinkDB All DBs Position 550587..550796 Genome browser AA seq 69 aa AA seqDB search MTNPFDNEDGKFRVLRNAEGQHSLWPTVAEVPDGWQVVHGEDSRKACLDYVEQHWTDMRP TSLITAMGE NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgaccaatccgtttgacaacgaggacgggaagttccgggtactgcgcaacgccgagggg cagcactcactgtggccgaccgttgcagaagttccggacggttggcaggttgttcacggc gaggatagtcgcaaggcgtgcctcgactacgtggagcagcactggaccgacatgcgcccc accagcctcatcactgccatgggcgaatga

DBGET integrated database retrieval system