Streptomyces koyangensis: D0C37_13670 Help Entry D0C37_13670       CDS       T06436                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sky  Streptomyces koyangensis Pathway sky00261   Monobactam biosynthesis sky01100   Metabolic pathways sky01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sky00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     D0C37_13670  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sky01008]     D0C37_13670 Polyketide biosynthesis proteins [BR:sky01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     D0C37_13670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AXQ55551 UniProt:  A0A385DCH6 LinkDB All DBs Position complement(3186668..3186877) Genome browser AA seq 69 aa AA seqDB search MSGGNPFDDADGVFHVLVNEEGQHSLWPVFAEVPAGWTAVLSDADRETAVAYVDENWTDM RPKSVARQS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagtggcggcaacccgttcgacgacgcggacggcgtcttccacgtcctggtcaacgag gaggggcagcactcgctgtggcccgtcttcgccgaagtgcccgccgggtggacggccgtt ctctccgacgccgaccgcgagacggcggtggcatacgtggacgagaactggaccgacatg cggccgaagagcgtggcacggcagagctga

DBGET integrated database retrieval system