Streptomyces koyangensis: D0C37_22630 Help Entry D0C37_22630       CDS       T06436                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism sky  Streptomyces koyangensis Pathway sky00020   Citrate cycle (TCA cycle) sky01100   Metabolic pathways sky01110   Biosynthesis of secondary metabolites sky01120   Microbial metabolism in diverse environments sky01200   Carbon metabolism sky01210   2-Oxocarboxylic acid metabolism Module sky_M00009   Citrate cycle (TCA cycle, Krebs cycle) sky_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:sky00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     D0C37_22630 Enzymes [BR:sky01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      D0C37_22630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  AXQ57122 UniProt:  A0A385DF59 LinkDB All DBs Position complement(5036651..5036905) Genome browser AA seq 84 aa AA seqDB search MTGYLCPGCRIEQHRACTGNNDWYMAGYGTPAVRTRCACPCCPQEVRGVCDRCGGPCDPQ TAVEHRTCRPAADATRHTPTEVIR NT seq 255 nt NT seq  +upstreamnt  +downstreamnt gtgaccggctacctctgccccggctgccgcatcgagcagcatcgcgcctgcacgggcaac aacgactggtacatggccggctacggcacgcccgccgtccggacccggtgcgcctgcccc tgctgtccgcaggaggtacgcggggtctgcgaccggtgcggcggaccgtgcgacccgcag accgccgtcgagcaccgcacctgccgacccgccgccgacgccacccgccatacccccacg gaggtcatccgatga

DBGET integrated database retrieval system